PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g36810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family MYB
Protein Properties Length: 486aa    MW: 53780.1 Da    PI: 5.329
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g36810genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-163380148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed++l+d+v ++G g+W+++ ++ g+ R++k+c++rw ++l
        Tp6g36810 33 KGPWSSAEDDILIDYVMKHGEGNWNAVQKHTGLFRCGKSCRLRWANHL 80
                     79******************************************9986 PP

2Myb_DNA-binding53.74.7e-1786129146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v++++++G++ W++ a++++ gRt++++k++w++
        Tp6g36810  86 KGAFSQEEEQLIVELHAKMGNR-WARMAAHLP-GRTDNEIKNYWNT 129
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8672880IPR017930Myb domain
SuperFamilySSF466891.76E-2931127IPR009057Homeodomain-like
SMARTSM007171.6E-143282IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-233487IPR009057Homeodomain-like
CDDcd001672.51E-113580No hitNo description
PfamPF139214.6E-163696No hitNo description
PROSITE profilePS5129426.31681135IPR017930Myb domain
SMARTSM007172.7E-1785133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2588134IPR009057Homeodomain-like
CDDcd001671.16E-1288129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MSYVSTESDH NESPFTDNGS DCRSRWEGNA LKKGPWSSAE DDILIDYVMK HGEGNWNAVQ  60
KHTGLFRCGK SCRLRWANHL RPNLKKGAFS QEEEQLIVEL HAKMGNRWAR MAAHLPGRTD  120
NEIKNYWNTR IKRRQRAGLP LYPPEMHVEV LDWNQEYTTS RILGGDRRQQ DFLQLGGCES  180
NVFFDSLDFV TDIVPGGPSD LACKILRNGG TSPRYGNFMP PIMPSSKRLR GSESLYPGCS  240
STIKEESLSP EHFQNTAQQK ISTTCSFSVP CDSDPPYGNQ RSPVMIPDCH TLTDGLVPTS  300
NPSFGAVKLE LPSFQYSEAT FDQWKKSASP PHSELLDPFD AYIQSPPPTG RKESDFFSSY  360
DTGLLDMLLL EAKFRNNSTK NSLSCTSATP SADVGEVNVS QIKSEEFHDS PNSLVPSEIS  420
ISAQHNADGV PLRIVKETGS MSEALAVLLG DDIGNDYMQM SVGGSSGVGS CAWSNMPPVC  480
QMTELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-322213413127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871198.10.0ATMYB33/MYB33
TrEMBLD7LZ380.0D7LZ38_ARALL; ATMYB33/MYB33
STRINGfgenesh2_kg.6__546__AT5G06100.30.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.30.0myb domain protein 33